SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001039777.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001039777.1.59421
Domain Number 1 Region: 644-780
Classification Level Classification E-value
Superfamily EF-hand 0.00000000191
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 474-527,564-688
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000141
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001039777.1.59421
Sequence length 970
Comment polycystin-2 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MVNSSRVQPQQPGDARRSPAPRAPGPGRLMAGGAIAGAGLAAPGGLREQRGLEIEMERIR
QAAARDPPAGASASPSPPLSSCSRQAWSRDNPGFEAEEEEEEEEVEGEEGGMVVEMDVEW
RPGSRRSASSSAVSSAGARGRGLGGYHGAGHPSGRRRQREDQGPPSPSPAGGGDPLHRHL
PLDGQHPRVAWAERLVRGLRGLWGTRLMEESSTDREKYLKSVLRELATYLLFLIVLCILT
YGMMSSSVYYYTRIMSQLFLDTPVSKMEKTNFKTLSSMEDFWKFTEGALLDGLYWKTQPS
NRTEADNRSFIYYENLLLGVPRIRQLRVRNGSCSIPLDLRDEIKECYDVYSVSSEDRAPF
GPRNGTAWIYTSEKDLNGSSHWGMIATYSGAGYYLDLSRTREETAAQVANLKKNVWLDRG
TRAIFIDFTVYNANINLFCVIRLLIEFPATGGVIPSWQFQPVKLIRYVTTFDFFLAACEI
IFCLFILYYVVEEILEIRIHKLHYFRSFWNCLDVVIIVLSVVAIGINIYRTSNVEALLQF
LEDQNTFPNFENLAYWQTQFNNIAAVIVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLF
GFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGP
IYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALIKLKLK
KNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQM
RDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEEDDDDSGHSSRRRGSISSGVSYEE
FQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDN
EIHREQMERLVREELERWESDDAASQISHGLGTPLGLNGQPRPRSSRPSSSQSTEGMEGG
GGNGSANIHV
Download sequence
Identical sequences Q4GZT3
9913.ENSBTAP00000026682 ENSBTAP00000026682 NP_001039777.1.59421 NP_001039777.1.76553 ENSBTAP00000026682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]