SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001039785.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001039785.1.59421
Domain Number 1 Region: 334-455
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Weak hits

Sequence:  NP_001039785.1.59421
Domain Number - Region: 23-79
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0759
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001039785.1.59421
Sequence length 458
Comment smoothelin-like protein 2 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MESAPDAEEARTVREALGRYEAALEGAVRALHEDMQGLQRGVEQRVAEALRLAGPLARTV
AELQRDNQRLQTQLERLTRQVESLGLTTGLAPAPGTPSPPPAPGVPNRAPRLGTARFASH
ATFSLSGRSQSLDHHDEASELEMRRTSNSCIIENGHQPGADPGDGPPEATQTIPAPEPPK
PRPVSLSLRLPHQPVTAVTRVSERFSGETSATALSPTSAAILGGLSSSPSEATTPWTPSP
SEKNSSLPRSLSSSGFGAMTASRNNNSPPLVTPPQSPPSPQPPATTQAHRPGERRRELVR
SQTLPRTSGAQARKALFEKWEQDTAGKGKGETRAKLKRSQSFGVASASSIKQILLEWCRS
KTLGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRRQNFELAFTMAENLA
NCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences Q2KI85
NP_001039785.1.59421 NP_001039785.1.76553 ENSBTAP00000027457 ENSBTAP00000027457 9913.ENSBTAP00000027457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]