SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001039844.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001039844.1.59421
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-51
Family Calponin-homology domain, CH-domain 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001039844.1.59421
Sequence length 297
Comment calponin-1 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFINKLQPGSVKKVNESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERRFEPEKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHPHNYYNSA
Download sequence
Identical sequences L8IVD8 Q2HJ38
ENSBTAP00000014883 9913.ENSBTAP00000014883 ENSBTAP00000014883 NP_001039844.1.59421 NP_001039844.1.76553 XP_005890825.1.15283 XP_006063945.1.26621 XP_010826612.1.44457 XP_019819776.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]