SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001040073.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001040073.1.59421
Domain Number 1 Region: 246-438
Classification Level Classification E-value
Superfamily Nudix 6.91e-45
Family NADH pyrophosphatase 0.001
Further Details:      
 
Domain Number 2 Region: 15-83
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000366
Family Ankyrin repeat 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001040073.1.59421
Sequence length 444
Comment peroxisomal NADH pyrophosphatase NUDT12 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MSSVKRSLNQEIISQFHYSAAEGDIAKLTAILSHSPSLLNETSENGWSALICDRSIVNKS
RQTALDIAKFWGYKHIANLLANAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDW
LLAKESHPATVYILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIF
LGVELEMKKEFFNYAGEISKEEEDGLVAWFALGIDTVAAEEFKQRHENCYFLHPPMPALL
QLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKRVCLKEDCPSLHGVHNTSY
PRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPGETIEDAVRREVEEESGVK
VGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDARWFTREQVVDVLTKGKQQA
FFVPPSRAIAHQLIKHWIGMNPNL
Download sequence
Identical sequences Q29RH3
ENSBTAP00000039749 NP_001040073.1.59421 NP_001040073.1.76553 XP_005889873.1.15283 ENSBTAP00000039749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]