SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001041378.2.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001041378.2.100692
Domain Number 1 Region: 43-142,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.71e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001041378.2.100692
Sequence length 450
Comment sulfide:quinone oxidoreductase, mitochondrial [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MAPLVAVVSSPRARLFACFLRLGTQQAGPLQLHTGACCTAKNHYEVLVLGGGSGGITMAT
RMKRRVGAENVAIVEPSERHFYQPIWTLVGAGAKELSSSDRSTLSVIPSGVQWIQDRVAE
LNPDQNCIRTDNGKEISYRYLIIALGIQLDYEKIKGLPEGFAYPKIGSNYSVKTVEKTWK
ALQDFKEGNALFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTALGTIFGVK
KYADALQEIIRERNVSVNYKHNLIEVRADKQEAVFENLDKPGETHVIHYEMLHVTPPMSS
PDVLKRSPVADSAGWVDVDKETLQHKKYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SLIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYTAQPLETFPFDQSKERISMYLMKAD
MMPFLYWNMMLRGYWGGPAFLRKLFHLGLS
Download sequence
Identical sequences B0BMT9
NP_001041378.2.100692 NP_001041378.2.4139 XP_006234949.1.100692 ENSRNOP00000061547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]