SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001068659.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001068659.1.59421
Domain Number 1 Region: 67-355
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.84e-113
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000014
Further Details:      
 
Domain Number 2 Region: 369-481
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.85e-27
Family Anticodon-binding domain of Class II aaRS 0.000000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001068659.1.59421
Sequence length 485
Comment DNA polymerase subunit gamma-2, mitochondrial [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MRSAPAIRACQRICRCLLSGFGGQVDGRQPEQLSKGTGSFVGPVRSQAELPRNEPREAPE
SGGEGSEPLVEICRKRRFLSGTKQQLSRDSLLNGCHPGLGPLGIELRKNLAAEWWSSVVV
FREQVFPVDALHREPGPSLPVDNGFRLVSAETLREILQDKELSKEQLVAFLENLLNTSGK
LRENLLHGALEHYVSYLDLVNKRLPFGLAQIGACFHPVSDTKQTPDGVKRIGEKTEASLV
WFTSARTASQWLDFWLRHRLLWWRKFAMSPSNFSSGDCQDEAGRKGNRLYYNFPWGKEPI
ETLWNLGDHELLHMYPGSVAQVHGRDGRKNVVPSVLSINGDLDRGMLAYLYDSFQLTENS
FTRKKDLHRKVLKLHPCLAPIKAALDVGRGPTVELRQVCQGLFNELLENGISVWPGYLET
VQSSLEQLYSKYDEMSILFTVLITEATLENGLIQLRSRDTTMKEMMHISKVKDFLTKYIS
SAKNV
Download sequence
Identical sequences Q0VC30
ENSBTAP00000024509 9913.ENSBTAP00000024509 ENSBTAP00000024509 NP_001068659.1.59421 NP_001068659.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]