SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001068667.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001068667.1.59421
Domain Number 1 Region: 226-318
Classification Level Classification E-value
Superfamily EF-hand 8.13e-18
Family EF-hand modules in multidomain proteins 0.0000073
Further Details:      
 
Weak hits

Sequence:  NP_001068667.1.59421
Domain Number - Region: 78-155
Classification Level Classification E-value
Superfamily Hsp90 co-chaperone CDC37 0.0942
Family Hsp90 co-chaperone CDC37 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001068667.1.59421
Sequence length 474
Comment nucleobindin-1 precursor [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MPPSGPRAALFLLPSLLLLRAVLAVPLERGAPKEENPATESPDTGLYYHRYLQEVINVLE
TDGHFREKLQAANAEDIKSGKLSRELDFVSHHVRTKLDELKRQEVSRLRMLLKAKMDAQQ
EPNIQLDHLNLLKQFEHLDPQNQHTFEARDLELLIQTATRDLAQYDAAHHEEFKRYEMLK
EHERRRYLESLGEEQRKEAERKLEEQQRRHREHPKVNVPGSQAQLKEVWEELDGLDPNRF
NPKTFFILHDINSDGVLDEQELEALFTKELEKVYDPKNEDDDMREMEEERLRMREHVMKN
VDTNQDRLVTLEEFLASTQRKEFGDTGEGWEQGKAGVPLPMAPVLTLQTVEMHPAYTEEE
LRRFEEELAAREAELNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLQMEQRKQQQQSH
NNPAPGPEGQLKFHPDTDDVPVPAPAGDQKDVDASEKKVPEQTPEPPQLDSQHL
Download sequence
Identical sequences Q0P569
ENSBTAP00000003073 NP_001068667.1.59421 NP_001068667.1.76553 XP_010813309.1.76553 9913.ENSBTAP00000003073 ENSBTAP00000003073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]