SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001068693.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001068693.1.76553
Domain Number 1 Region: 66-175
Classification Level Classification E-value
Superfamily L domain-like 1.15e-16
Family Ngr ectodomain-like 0.00059
Further Details:      
 
Domain Number 2 Region: 202-290
Classification Level Classification E-value
Superfamily Immunoglobulin 7.01e-16
Family I set domains 0.043
Further Details:      
 
Domain Number 3 Region: 283-383
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000328
Family I set domains 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001068693.1.76553
Sequence length 476
Comment BDNF/NT-3 growth factors receptor precursor [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MSSWTRWHGPAMARLWGFCWLIVGFWRAALACPTSCKCSASRIWCGDPSPGIVAFPKLEA
TSADPENITEIYIANQKRLEIINEDDLEAYVGLKNLTIVDSGLKSVAHKAFLKNSNLQHI
NFTRNKLTILSRKHFRHLDLSELILVGNPFTCSCDVMWIKTLQETKPSPETQDLYCLDEN
SKNISLANLQIPHCGLPSANLAAPNLTVEEGKSITLSCTVAGDPVPNLYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYK
LVAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNKSNGTLPT
GVVDTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIPLDG
Download sequence
Identical sequences Q0VCN4
ENSBTAP00000014097 NP_001068693.1.59421 NP_001068693.1.76553 XP_005210434.1.76553 XP_019822061.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]