SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001068776.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001068776.1.59421
Domain Number 1 Region: 13-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.07e-44
Family Dual specificity phosphatase-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001068776.1.59421
Sequence length 198
Comment dual specificity protein phosphatase 14 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MSSRGHSTLPRTLMAPRMISEGDLGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNAT
IEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSAT
LCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGI
VPDVYEKESRHLLPYWGI
Download sequence
Identical sequences L8J2P9 Q17QM8
ENSBTAP00000013570 9913.ENSBTAP00000013570 NP_001068776.1.59421 NP_001068776.1.76553 XP_005220051.1.76553 XP_005888229.1.15283 XP_010814059.1.76553 XP_010859837.1.44457 XP_010859838.1.44457 XP_019836906.1.53367 XP_019836907.1.53367 ENSBTAP00000013570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]