SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001069047.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001069047.1.76553
Domain Number 1 Region: 155-309
Classification Level Classification E-value
Superfamily EF-hand 2.61e-24
Family Calmodulin-like 0.073
Further Details:      
 
Domain Number 2 Region: 59-177
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000121
Family Calbindin D9K 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001069047.1.76553
Sequence length 317
Comment reticulocalbin-2 precursor [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MQLGPRPATLGLLLLCAAAAGAGEAEELHYQQGEHRADYDREALLGGQEEVDEYVKLSPE
EQHKRLKSIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFIEYDKNSDGSVSWD
EYNIQMYDRVIDFVENTALDDAEEESFRQLHLKDKKRFEKANQDSGPGLNLEEFIAFEHP
EEVDYMTEFVIQEALEEHDKDGDGFVSLEEFLGDYRRDPTASEDPEWILVEKDRFMNDYD
RDADGRLDPQELLSWVVPNNQGIAQEEARHLIDEMDLNSDRKLSEEEILENQDLFLTSEA
TDYGRQLHDEYFYHDEL
Download sequence
Identical sequences Q0VCQ9
NP_001069047.1.59421 NP_001069047.1.76553 ENSBTAP00000020950 ENSBTAP00000020950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]