SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001069115.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001069115.1.76553
Domain Number 1 Region: 23-164
Classification Level Classification E-value
Superfamily EF-hand 7.87e-34
Family Calmodulin-like 0.000000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001069115.1.76553
Sequence length 170
Comment myosin regulatory light chain 2, skeletal muscle isoform [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MAPKKAKRRAAAEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGR
LNVKNEELDAMMKEASGPINFTVFLNMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKF
LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Download sequence
Identical sequences Q0P571
NP_001069115.1.59421 NP_001069115.1.76553 XP_019843021.1.53367 9913.ENSBTAP00000028269 ENSBTAP00000028269 ENSBTAP00000028269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]