SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001071485.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001071485.1.76553
Domain Number 1 Region: 10-164
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.35e-40
Family Dual specificity phosphatase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001071485.1.76553
Sequence length 196
Comment dual specificity protein phosphatase 21 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MTTPLCPFPIQAVRQPAAHGLSQITKSLYLSDAVAAKDKAMLSTNHITTVINVSMEATDT
FLEDIQYVKVPLADAPNSRLYDFFDFIADHIHSVEMKQGRTLLHCAAGVSRSATFCLAYL
MKYHSMSLLDAHTWTKSCRPTIRPNNGFWEQLIYYEFKLFSKNTVHMISSSMGMIPDVYE
KEICLMTLMGVIPDSS
Download sequence
Identical sequences L8ISI2 Q0II40
ENSBTAP00000002365 NP_001071485.1.59421 NP_001071485.1.76553 XP_005891410.1.15283 XP_019811191.1.53367 ENSBTAP00000002365 9913.ENSBTAP00000002365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]