SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001072337.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001072337.1.99540
Domain Number 1 Region: 313-590
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-71
Family Kelch motif 0.0000342
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 3.37e-35
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001072337.1.99540
Sequence length 600
Comment kelch-like protein 24 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MVLILGRRMNREEGGVRESPATKRKVFEMDQKQLTGHEVFDFNSGSSHSESILQVFNEFR
ENRLFTDVIICVEGREFPCHRAILSACSSYFRAMFCNDHRESREMLVEINGIFAEAMDCF
LQYVYTGRVKITTENVQYLFETSSLFQISVLRDACAKFLEEQLDPCNCLGIQHFADTHSL
KTLFTKCKSFAQQAFEDVVQHEEFLELGKAELIDYVSTDELVVSKEELVFEAVMRWVYHH
VDVRRPMLQELLTHVRLPLLHPNYFVQTVEVDQIIQNAPDCYQLLHEARRYHILGNEMMS
PRTRPRRSTGYSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKSLAKLPEFTKSEYAVCA
LRNDILVSGGRINSRDVWIYNSQLNIWIRVASLNKGRWRHKMAVLLGKVYVVGGYDGQNR
LSSVESYDSFSNRWTDVAPLKEAVSSPAVASCVGKLFVVGGGPDDNTCSDKVQCYDPDNN
TWLLRASIPIAKRCITAVSLNNLIYVAGGLTKAIYCYDPVEDYWIHVQNTFTRQENCGMS
VCNGKIFILGGRGENGEATDTILCYDPATSIITGVAAMPRPVSYHGCVTIHRFNEKAFKM
Download sequence
Identical sequences Q0V9R8
gi|111308087|gb|AAI21420| gi|118403467|ref|NP_001072337| gi|169642150|gb|AAI60560| ENSXETP00000030304 NP_001072337.1.99540 ENSXETP00000030304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]