SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001072373.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001072373.1.99540
Domain Number 1 Region: 54-427
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.96e-46
Family Integrin alpha N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 553-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000787
Family EGF-type module 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001072373.1.99540
Sequence length 646
Comment cartilage acidic protein 1 precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mlpadffvpvskmmllalllsiiiccggaqrsepmftavtdtvlpqdydsnptqlnygva
itdvdndgdfevvvagyngpnlvlkyikekghlvniavdersspyyalrdrqgnaigvaa
cdidgdgreeiyflntnnafsgiatysdklftfrngrwedlfsdevnlrrgvanrfsgrs
vacidrkgsgrysfyianyangnvgphalieldetasnlsrgiivlsnvaaelglnkytg
grgiavgpivnsaasdifcdnengpnflfqnkgdgtfvdiasstgvddvyqhgrgvalad
fnrdgkvdivygnwngphrlflqmntngkvrfrdiatqkfsmpspirtviaadfdndqel
evffnniayrgpsanrmfrvgrrehadpfmeelnpgdasepdgrgtggavtdfdgdgmld
lilshgesmaqplsvfkgkqglknnwlrviprtkfgafargakvvlytkksgahlriidg
gsgylcemepvahfglgkdeasslevtwpdgkiftrsvaegeinsvldiaypheddtvtk
ptdiecgqgfsvnengrctdtdeciqfpfvcprekpvcintyggykcrpnrrcsrgfepn
edgtacvaqvayfgsypssasrsqalflhctasllglgfyfqiytl
Download sequence
Identical sequences NP_001072373.1.99540 gi|111309064|gb|AAI21478| gi|118404102|ref|NP_001072373|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]