SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001072385.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001072385.1.99540
Domain Number 1 Region: 468-598
Classification Level Classification E-value
Superfamily TIMP-like 7.38e-35
Family Netrin-like domain (NTR/C345C module) 0.054
Further Details:      
 
Domain Number 2 Region: 278-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000131
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 396-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 4 Region: 333-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 5 Region: 101-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000901
Family Galactose-binding domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001072385.1.99540
Sequence length 601
Comment netrin 1 precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MPRILWGFIPFYIISLLCPVPRGQENNSNKASTHGGTPDGPCYDAKQRPKYCIPDFINVA
LGQEVITSNTCGRTPQKLCYFLDSTNVTSRRCQLCDQKRPENSYPPSYMTDTDAQTCWKS
ESGITFPQNVTLTLPLGRRFELVYASLRFCSPRPDSMAIYKSMDYGKTWIPFQFYSTHCR
RVYDQATTSAISKPMQHEATCTDFQTGVKPLTKGLVAFMPLAGRPSARRFEYSPVLQDWV
TATDIRVVFNRLHHGKKMGIRRKTAFYGVSEIQVGGRCKCNGHASRCTAGKEGLMCECQH
NTIGPECDACKPFYYDRPWQRATPSNAHECVACECNLHSHRCRFNMELYKLSGRKSGGVC
LNCRHNTAGRHCHYCKQGYKRDLSKPITSRKACKPCQCHPIGAVNAMCNQTTGQCQCKTG
VTGPTCNRCAPGYQQSRSAHMPCVRIQEEMTTTASYPQEWKAGTNGTECQSYCKPSHSRV
HMNLRKYCKKDYVLRAQLLSMEKSGEWWQFTATVLTVYRQRRVPIRRGDQPLWVPDHDLA
CDCLRVQVGKSYLIIGNDEESPDPARLILDKNSLALPWRDVWGHKLRRFQQQERRGKCRV
G
Download sequence
Identical sequences Q0V9H1
ENSXETP00000063547 NP_001072385.1.99540 gi|111306023|gb|AAI21569| gi|118404128|ref|NP_001072385| ENSXETP00000063547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]