SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001072726.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001072726.1.99540
Domain Number - Region: 801-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00395
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 408-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0144
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 322-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0275
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 672-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0318
Family Laminin-type module 0.013
Further Details:      
 
Domain Number - Region: 367-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.072
Family Laminin-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001072726.1.99540
Sequence length 1114
Comment multiple epidermal growth factor-like domains protein 10 precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MVHSLKWLGIFPLILFQWLGTTSSLNLEDPNVCSHWESYSVTVQESYSHPYDQVYYTSCT
DILNWFKCTRHRISYRTAYRRGEKTMYRRKSQCCPGFYESREMCVPHCADKCVHGRCIAP
NTCQCEPGWGGPNCSSACDVDHWGPHCSSRCQCKNGALCNPITGACHCSSGYKGWRCEER
CDQGTYGNDCQQKCQCQNGASCDHVTGECRCPPGYTGAFCEDLCPPGKHGSQCEERCPCQ
NGGVCHHVTGECSCPAGWMGTVCGQPCPEGRYGRNCSQECQCHNGGTCDSATGQCYCSPG
YNGERCQEECPVGLYGVKCAQTCQCLNGGKCYHISGACLCEPGYTGERCETPLCSEGTYG
MKCDKKCPCHLQYTQSCHPMSGECACKPGRSGLYCNETCSLGFYGEFCQQICSCQNGADC
DSVTGKCICAPGFTGVDCSTACPPGTYGVNCSSLCNCKNNAVCSPVDGSCTCKAGWHGVD
CSINCPRGSWGLGCNLTCQCLNGGACNPLDGTCTCAPGWRGLKCELPCQDGTYGMNCIER
CDCSHADGCHPATGYCRCLAGWAGMHCDSVCPGGHWGPNCSLSCDCKNGASCSPDDGICE
CAPGYRGTTCQRICSPGFYGHRCSQACPQCVHSNGPCHHVTGQCDCLAGFMGSLCNEVCP
SGRYGKNCAGVCACTNNGTCNPIDGTCQCYPGWIGNDCSQACPPGHWGPNCIHTCNCHNG
AYCSAYDGECKCSPGWTGLYCTQRCPLGYYGKECTLVCQCQNGADCDHITGQCTCRTGFM
GKFCEQKCPSASYGYGCRQVCDCLNNSTCDHITGTCYCSPGWKGARCDQAVMIVVGNLNS
LSRTSAAIPADSYQIGAIAGIIILVLVVLFLLALFIIYRQKQKGKDTAMPAVAYTPAVRV
LSTDYTIADTLPHNNVVNANSQYFSNPSYHTLSQCTTGPQVNSMDRMMVSRSKSSQLFVN
LKNLDPGKRSHTIDYTGTLPADWKQGGFLNENGLLKNSAYSISTCSLSSTENPYATIKDP
PVLLPKNIECGYVEMKSPARRDSAYAEISNSSLANKNVYEVEPTVSVVQGAFCNNGKISQ
DLYDLPKNSHIPCHYDLLPVRESSSSNKDESTSE
Download sequence
Identical sequences A0JM12
gi|116487753|gb|AAI25697| gi|118404388|ref|NP_001072726| gi|160409991|gb|A0JM12| ENSXETP00000034579 ENSXETP00000034579 NP_001072726.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]