SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001073041.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001073041.1.99540
Domain Number 1 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000128
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 863-915
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000198
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 384-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000108
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 699-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000229
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 5 Region: 920-969
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000115
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 768-845
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000303
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 825-871
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000583
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  NP_001073041.1.99540
Domain Number - Region: 291-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000128
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 425-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00983
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 2-23,99-119
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0138
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001073041.1.99540
Sequence length 1198
Comment zinc finger protein ZFAT [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MCKLCNLFSPNHSELVRHVSDNHTEEGLTAGDIIIPLRPLAASNRSGDDLSAVKRKRGRP
KGSTKKSIAEEESTEQSSNASGDLLPETDEKPDPVPENLECRKCSRTFSNVRQLKKHICI
IVLNDDEDVTSGNDFEGKFIQPESDKERERQPKRSRVQKTDKSAQPKDSDKAQGVHPIVR
VLLTAHEAIPGATKIIPIEAETPEAEPEINPQTSEQEQVQRKGYQEYAIQQIPTELATKA
NRVGPTQLKIFTCEYCNKVFKFKHSLQAHLRIHTKEKPYKCSLCSYASAIKANLSVHMRK
HTGEKFSCDHCTFSCLSKGHLKVHVERVHKKIKQHCRFCKKKYSDVKNLIKHIKETHDLL
DKKVQETFDELRLRTREGKRQLLYDCHICERKFKNELERDRHMLVHGDERPFACELCGHG
ATKYQSLELHIRKHPFVYVCSFCCKKFVSTVRLKAHIKERHSDAQEALVYNDSINQSFCL
LEPGSDIQPEALRDIENPAKPLTLNGDLSLVPELHSTGQENTIQTDALGTTSEGQQESMG
AFQVAEKEPGTCLPILENGVDPKAGPLSTLGSVENEISCKGFVPLSSENENNHFSSEHEP
VEGLHSAPATNQAADNILGSAVLEEGARNVSSTTEQSTEVAEGGPNPTTEPSSHLLASNP
PPSSPGETAAFMAILNGLHKRQLSTALMQKIRKIYGELECEYCGKLFWYQVHYDMHVRTH
TREHLYYCSQCSYSSITKNCLKRHVIQKHSSLLLKCPSEGCNYSSPDKYKLQTHIKIHTD
LEKKTYSCPSCEKSFSDDRLIKSHIKTNHPEVPSSLISEVLGRKVQMKGLIGKRAVKCPF
CDSYFMKNGSDLQRHIWAHEGLKPFKCSMCDYATRSKSNLKAHMNRHSTEKTHLCDMCGK
KFKSKGTLKSHKLLHTSDGKQFKCTVCEFTAVQKRHLVRHMEQHTSFKPFGCALCHYSCN
IPGSLKRHYNKKHPDKQCVNAGTGEISQEALLLQGGMKCPVCSFVYGTKWEFNRHLKNKH
GLKLVENEGDAKWESLDTTEETCTQYLHIADTETDVQGTEAAVAALQDLRYTSDTSDKLD
PTAVNILQQIIELGAEPHDAAAVASVVAMAPGTVTVVEQVTEEERTTNHAVMIQEALQQA
SVGLGEQHHLVVSADDVEGIETVTVYTQGEEASEFIVYVQEAMQPVGDGTMEHILQEI
Download sequence
Identical sequences Q0VA30
NP_001073041.1.99540 gi|111305925|gb|AAI21282| gi|118601156|ref|NP_001073041|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]