SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001074199.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001074199.1.59421
Domain Number 1 Region: 133-308
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.06e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 83-127
Classification Level Classification E-value
Superfamily TGS-like 0.0000654
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001074199.1.59421
Sequence length 335
Comment 39S ribosomal protein L39, mitochondrial [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MAVVVRGMRLWRAAPSGGAAWRSVVTSPASQLSPTELIEMQNDLFNKEKNRQLSLTPRTE
KIEVKHVGKTDPGTIFVLNKNVSTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLTKSC
EIKFLTFKDDDPGEVNKAYWRSCAMIMGCVIERAFKEEYVVHLVRAPEVPVIAGAFCYDV
VLDKRLDEWMPTKENLRSFTKDARALIYKDLPFETLEVEAKVALEIFQHNKYKVDFIEEK
ASQNPERIVKLHRFGDFIDVSEGPLIPRTSICFQYEVSVVHNLQATQSSLVRRFQGLSLP
VHLRAHFTIWNKLLERSRKMVTEDQTKPTEKSAST
Download sequence
Identical sequences Q05B74
ENSBTAP00000026038 ENSBTAP00000026038 NP_001074199.1.59421 NP_001074199.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]