SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001074200.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001074200.1.76553
Domain Number - Region: 126-188
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0902
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001074200.1.76553
Sequence length 214
Comment biogenesis of lysosome-related organelles complex 1 subunit 4 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEDFPPSCGPVAEEEAEAQVAAWSGDSGNVSQSHSSASGPWEDEGPESGAPSRDPPLLRR
AAAGYASCLLPGAGARPEIEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVGEGVPLIYA
KATEMRRVYSKIDRLEAFVGMVSASVARLEEQVARAEAELGTFPSTFRKLLHTINVPSFF
HKAPSSRSQLTGYEPPVVFRTEDHFPCCSERPQV
Download sequence
Identical sequences Q0VCC3
9913.ENSBTAP00000004899 ENSBTAP00000004899 ENSBTAP00000004899 NP_001074200.1.59421 NP_001074200.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]