SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001074811.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001074811.1.92730
Domain Number 1 Region: 88-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-24
Family Pentraxin (pentaxin) 0.027
Further Details:      
 
Weak hits

Sequence:  NP_001074811.1.92730
Domain Number - Region: 591-855
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0403
Family Rhodopsin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001074811.1.92730
Sequence length 903
Comment adhesion G-protein coupled receptor D1 isoform 3 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MKDLPAFPCSWVWLLWSFCSVQVCSTQPRAQEHPGFAVLASASHYWPLENVDGILELQDT
TGALRTLNLTVPLSHNATFVFTNDSAYSNLSATVDIMEGKVNKGIYLKEEKGVTFLYYGT
YKSSCISNPAQCGPEGVTFSFFWKTQGDQTRPAPYAYGGQVVSDGFKVCSSGGKGSVELY
TRDNSMTWKATFNPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSHTYGDPHVNL
VIGSEQDQTKRYENGAFDEFIIWERALTPDEIKMYFTAAIGKHALLSSTPPAMPTAHTVI
PTDAYHPIITNLTEERKRFQRPGTVLRYLQNVSLRLPNKSLSEETALNLTETFLRTVGEV
LLLPSWTHESEDNAMTLGLVDTIDTVMGHISSNLQSREPHVTLTGSSSTAEFTVAKVLPP
ALSAPHYRFPAHGHSYIEIPREALHSQAWTTIVGLLYHTMHYYLKNIHPTSTEIPEAVNC
RDCLLSVASHLISLEVSPPPTLSQNLSGSPLITVHLRHKLTQKQYSDATNESNRLFLYCA
FLNFSSGEGVWSSQGCALTEGNLTYSVCHCTHLTNFAILMQVVPLKLTHGHQVALSSISY
VGCSLSVLCLAATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLISFSMEPGTVP
CQVLAVLLHYFFLTAFAWMLVEGLHLYSMVIKVFGSEDSKHLYYYGIGWGCPLLICIISI
SSSMDSYGTSDSCWLALGSGAIWAFVGPALLVIVVNIVILVAVTRVISHISTDSYKIHGD
PSAFKLTAKAVAVLLPILGTSWVFGVLAVSDRALVFQYMFAILNSLQGLFIFLFHCLLNS
EVRAAFKHKTKVWSLTSSSARTANTKPFSSDTVNGTRPGTASTKLSPWDKSSHSAHRVDL
SAV
Download sequence
Identical sequences Q80T32
ENSMUSP00000060307 NP_001074811.1.92730 ENSMUSP00000060307 ENSMUSP00000060307 10090.ENSMUSP00000060307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]