SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001074829.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001074829.1.92730
Domain Number 1 Region: 1334-1472
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 240-341
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000982
Family Calponin-homology domain, CH-domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001074829.1.92730
Sequence length 1478
Comment calmodulin-regulated spectrin-associated protein 2 isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MGDAADPREMRRTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELGDPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMISIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWMNKVNEHLKDIMEQEQKSKEHHPAEAPGGQKAGLEHTFCHSPILIALIARYRKEQT
LLKQLPCIPLVENLLKDGTDGCALAALIHFYCPAVVRLEDICLKETMSLADSLYNLQLIQ
EFCQEYLNHCCHFSLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQGAEP
AKDVPSVPVLNAAKRNIRDSSSSSDFSSRYTRPQTHSSASGGIRRSSSMSYVDGFIGTWP
KEKRTSVHGVSFDISFDKEDSAQSSTPNRGIIRSVSNEGLTLNNSRASKHIRKNLSFKPV
NGEEEESIEEELHVDPHGDLQSPMPLNTNELNSNESTHYKLPNGALQNRVLLDEFGNQIE
TPSIEEALQIIHDTERPPHTPRPDQIANGFFLHGQDLSILNSNIKLNQSSPDNLTDTKGA
LSPITDTTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKLLQDYDLRASNPR
EALSPCPSTISTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSSSQKTTPEGSE
LNIPHVVSWAQIPEEAGVAPGRDTTQLLASEMVHLRMRLEEKRRAIEAQKKKMEAAFTKQ
RQKMGRTAFLTVVKKKGEGISPLREEAAGAEDEKVYTDRAKERESQKMDGQRSKSLADIK
ESMETPPGRWLKSPTTPVDPERQWNLTSPSEETLNEGEILEYTKSIEKLNSSLHFLQQEM
QRLSLQQEMLMQMREQQAWVISPPQPSPQKQIRDFKPRQAGLSSAAAPFSSDSPRPTHPS
PQSSTRKSASFSVKNQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFSPSQVPIQTRSF
VCFGDDGEPQKEPKQKEEIKKEPSECKGTLGPCDHNPGEKEIKPVESTVSEVLSQPITET
VCVTPNEDQLSQPTEPPPKPVFPPTAPKNVNLIEVSLSDLKPPEKADVSVEKLDGESDKE
QFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQLEAEMEHKKEET
RRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQAAKQKKQRPKSIHR
DHIESPKTPIKGPPVSSLSLASLNTGDSESVHSGKRTPRSESVEGFLSPSRCGSRNGEKD
WENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEME
KSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQF
SHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences H7BX08
ENSMUSP00000041920 10090.ENSMUSP00000041920 ENSMUSP00000041920 NP_001074829.1.92730 ENSMUSP00000041920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]