SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001076588.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001076588.1.92730
Domain Number 1 Region: 878-1182
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.92e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000555
Further Details:      
 
Domain Number 2 Region: 1141-1442
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.22e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000153
Further Details:      
 
Domain Number 3 Region: 25-186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-36
Family MAM domain 0.00000592
Further Details:      
 
Domain Number 4 Region: 386-585
Classification Level Classification E-value
Superfamily Fibronectin type III 1.62e-27
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 5 Region: 284-415
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000154
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 6 Region: 189-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000115
Family I set domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001076588.1.92730
Sequence length 1446
Comment receptor-type tyrosine-protein phosphatase U isoform 2 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MARAQALVLALTFQFCAPETETPAAGCTFEEASDPVVPCEFSQAQYDDFQWEQVRIHPGT
RTPEDLPHGAYLMVNASQHAPGQRAHIIFQTLSENDTHCVQFSYFLYSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALISPDHKGYIGLDDIL
LFSYPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAEHFFLQRQSGVLVPAAGVRHI
SHRRFLATFPLASVGRSEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPT
YLIIQLNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVNLQTYKLWHLDPDTEYEISVLLT
RPGDGGTGRPGPPLISRTKCAEPTRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYAVS
LCYRYTLGGSHNQTIRECVKMERGASRYTIKNLLPFRNIHVRLILTNPEGRKEGKEVTFQ
TDEDVPGGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPR
RTISKLRNETYHVFSNLHPGTTYLFSVRARTSKGFGQAALTEITTNISAPSFDYADMPSP
LGESENTITVLLRPAQGRGAPISVYQVVVEEERPRRLRREPGAQDCFSVPLTFETALARG
LVHYFGAELAASSLLEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNC
IRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGRDRYAYS
YYPKPVNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDAPGYSPRGDQRS
GGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYES
FFEGWDATKKKDKLKGGRQEPVSAYDRHHVKLHPMLADPDADYISANYIDGYHRSNHFIA
TQGPKPEMIYDFWRMVWQEQCASIVMITKLVEVGRVKCSRYWPEDSDMYGDIKITLVKTE
TLAEYVVRTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGP
IVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDA
ILEACLCGETTIPVNEFKATYREMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALL
PRNRDKNRSMDVLPPDRCLPFLISSDGDPNNYINAALTDSYTRSAAFIVTLHPLQSTTPD
FWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFVSGTANEDLVSRV
FRVQNSSRLQEGHLLVRHFQFLRWSAYRDTPDSRKAFLHLLAEVDKWQAESGDGRTVVHC
LNGGGRSGTFCACATVLEMIRCHSLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYL
EALELR
Download sequence
Identical sequences B1AUH1
NP_001076588.1.92730 10090.ENSMUSP00000030741 NYSGRC-IgSF-B1AUH1 ENSMUSP00000030741 ENSMUSP00000095472 ENSMUSP00000030741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]