SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001076913.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001076913.1.59421
Domain Number 1 Region: 17-109
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.01e-28
Family Cytochrome b5 0.0015
Further Details:      
 
Weak hits

Sequence:  NP_001076913.1.59421
Domain Number - Region: 337-398
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0511
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001076913.1.59421
Sequence length 444
Comment fatty acid desaturase 2 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MGKGGNQDEGATELEAPMPTFRWEEIQKHNLRTDKWLVIDRKVYNITKWSSRHPGGQRVI
GHYAGEDATDAFLAFHRNLDFVRKFMKPLLIGELAPEEPSQDRGKNSQITEDFRALRKTA
EDMNLFKSNQLFFLLHLAHIIAMESIAWFTLFYFGNGWIPTIITAFVLATSQAQAGWLQH
DYGHLSVYKKSMWNHIVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFV
LGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPLYFQYQIIMTMIVRKYWADLAWAI
SYYTRFFITYIPFYGVLGSILFLNFIRFLESHWFVWVTQMNHIVMEIDREPYRDWFSSQL
AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVRSLCAKHGIEYQEKPLL
RALQDIIGSLRKSGQLWLDAYLHK
Download sequence
Identical sequences A4FV48
NP_001076913.1.59421 NP_001076913.1.76553 ENSBTAP00000020610 ENSBTAP00000020610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]