SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001078859.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001078859.1.92730
Domain Number 1 Region: 168-319
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.44e-44
Family Dual specificity phosphatase-like 0.0000193
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.02e-23
Family Cell cycle control phosphatase, catalytic domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001078859.1.92730
Sequence length 384
Comment dual specificity protein phosphatase 5 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MKVTSLDGRQLRKMLRKEAEARCVVLDCRPYLAFAASSVRGSLNVNLNSVVLRRARGGAV
SARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGP
RVYFLKGGYETFYSQYPECCVDVKPTSQEKIEGERSLLSQCGKPVLSVAYRPAYDQGGPV
EILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACTTHLHYKWIPVEDSHTADISS
HFQEAIDFIDCVREEGGKVLVHCEAGVSRSPTICMAYLMKTKQFRLKEAFDYVKQRRSVV
SPNFGFMGQLLQYESEILPSTPTLQPPSCQGEAASSTFIGHLQTLSPDMQGTYCTFRTSV
LAPVPTHSTVPELHRSPVATATSC
Download sequence
Identical sequences Q1HL35
ENSMUSP00000047900 ENSMUSP00000047900 ENSMUSP00000047900 10090.ENSMUSP00000047900 NP_001078859.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]