SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001079150.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001079150.1.7800
Domain Number 1 Region: 220-490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-77
Family Protein kinases, catalytic subunit 0.00000000171
Further Details:      
 
Domain Number 2 Region: 112-250
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-38
Family SH2 domain 0.0000139
Further Details:      
 
Domain Number 3 Region: 52-136
Classification Level Classification E-value
Superfamily SH3-domain 2.54e-20
Family SH3-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001079150.1.7800
Sequence length 496
Comment HCK proto-oncogene, Src family tyrosine kinase L homeolog [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MGCIKSKDSNTTGKSLGPPESTQTHYVKDPTSTVTMTKPERSSKHPREEGQEEVVLLALY
DYDGVHPGDLTFRKGDHLLLKKESGEWWEACLISTGEEGFVPSNYVAYFNSLESEEWYFK
GMSRKEAERQLLSPVNKSGAFMIRDSETMKGCFSLSVRDSGDTVKHYKIRTLDDGGFFIS
TRIPFPSLPELVRHYQGKVDGLCQCLTIPCQTVRPEKPWEKDAWEIPRESLSLQKKLGAG
QFGDVWLAMYNGHTKVAVKTMKPGSMSPGAFLEEANLMKSLQHDRLVRLHAVVTQGEPIY
IITEYMQKGSLLDFLKSEEGSDQPLIQLIDFSAQIAEGMWFIEQRNYIHRDLRAANCLVS
ETLLCKIADFGLARVIEDSEYTAREGTKFPIKWTSLEAANYGSFTIKSDVWSFGVLLTEI
ITYGRTPYPGMSNSEVITALERGYRMPCPSTCPKELYSIMLQCWQQDPEQRPTFEYLQSI
LEDFFTATETQYQAQP
Download sequence
Identical sequences O93411
NP_001079150.1.7800 gi|147901528|ref|NP_001079150| gi|3411274|gb|AAC31209|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]