SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001084005.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001084005.1.7800
Domain Number 1 Region: 24-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.24e-35
Family PDI-like 0.0000287
Further Details:      
 
Domain Number 2 Region: 361-472
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.5e-32
Family PDI-like 0.00086
Further Details:      
 
Domain Number 3 Region: 232-365
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.37e-28
Family PDI-like 0.016
Further Details:      
 
Domain Number 4 Region: 139-235
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.61e-21
Family PDI-like 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001084005.1.7800
Sequence length 506
Comment prolyl 4-hydroxylase, beta polypeptide L homeolog precursor [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MMRAVLLFGCALLVVARPDISEEKDVLVLKKDNFDEALKQYPYILVEFYAPWCGHCKALA
PEYEKAAGILKSEGLPIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKSSPKEYSAGR
EAADFVNWLKKRTGPAASTLSDEAAVAALVASSEVAVIGFFKDLESELAKVFLQAAEAVD
DVPFGITSSEAAFSKHELGKDGIVLFKKFDEGRNAFEGEITKEEVLSFIKANRLPLVIEF
TEQTAPMIFGGEIKTHILFFLPKSASDYQDKLENFKKAAASFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESSDLSAEAIKEFCDRFLEGKVKPHLMSQDV
PEDWDKTPVKILVGKNFEEVVFDEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHESI
IIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKKVVDYNGERTQEGFSKFLESGGQDGAAD
EDLEDLEEADETDLEEGDDIHTKDEL
Download sequence
Identical sequences Q6DD55
gi|147906935|ref|NP_001084005| gi|50414764|gb|AAH77772| NP_001084005.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]