SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001086217.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001086217.1.7800
Domain Number 1 Region: 97-238
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.37e-26
Family Glutathione S-transferase (GST), C-terminal domain 0.0000189
Further Details:      
 
Domain Number 2 Region: 21-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.85e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001086217.1.7800
Sequence length 240
Comment chloride intracellular channel 3 L homeolog [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MAEQGQFTLELFVKASDDGESIGNCPFCQRLFMILIHKGVPFTLTTVDMKRAPEVLKDLA
PGSQPPFLLYNNEVKTDTNKIEEFLEELLQPPSYPRMTPKYKESNTVGNYIFHKFSAYIK
NQLPAQEETLQRNLLKYLLLLDQYLLAPLPHEIKNNPNQRVSHRKFLDGDNLTLPDCNLL
PKLNIINTVCKYYRKFEIPRDLEGVTRYLENASQMKEFKYTCPNTEEILLFYRTVVKPMK
Download sequence
Identical sequences Q6GLV9
NP_001086217.1.7800 gi|147898897|ref|NP_001086217| gi|49256277|gb|AAH74338|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]