SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001086643.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001086643.1.7800
Domain Number 1 Region: 20-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.38e-34
Family PDI-like 0.003
Further Details:      
 
Domain Number 2 Region: 162-270
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.45e-33
Family PDI-like 0.005
Further Details:      
 
Domain Number 3 Region: 283-393
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000104
Family Thioltransferase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001086643.1.7800
Sequence length 442
Comment protein disulfide isomerase family A member 6 L homeolog precursor [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MARAFLGAVACTLILAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQR
LTPDWKKAATALKGVVKVGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTA
DAIVDAALNSLRSFVKDRLGGRSGGSDSGRQSHSGGSGGSKKDVIELTDDTFDKNVLNSD
DVWLVEFFAPWCGHCKSLEPEWAAAATEVKEKTNGKVKLAAVDATVSQVLASRYGIRGFP
TIKIFQKGEEPVDYDGGRNRADIVARALDLFSENAPPPEINEILNGDIVKKTCDEHQLCI
VAVLPHILDTGAAGRNSYLEVMLKMAEKYKKKMWGWLWTEAGAQMDLETSLGIGGFGYPA
MAAINARKIKFALLKGSFSEQGINEFLRELSYGRGSTSPVGGGAIPKINTVEPWDGKDGE
LPAEDDIDLSDVELDDIGKDEL
Download sequence
Identical sequences Q6DEA4
gi|147906274|ref|NP_001086643| gi|50418205|gb|AAH77228| NP_001086643.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]