SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001090653.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001090653.1.99540
Domain Number 1 Region: 1534-1586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 1637-1694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000415
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 40-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000134
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 1600-1651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000207
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 5 Region: 1683-1734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000265
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 6 Region: 1282-1327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000217
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 1510-1543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000378
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Weak hits

Sequence:  NP_001090653.1.99540
Domain Number - Region: 1109-1143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000127
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number - Region: 942-981
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00304
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001090653.1.99540
Sequence length 2009
Comment zinc finger protein 605 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MQGKERSATALDGWVATRQTLVAGGNQETDGPPGGAGGQYLCMECNETFNSKVQLSSHRQ
SHVAKKPFMCSYCGRGFHHQVFLQVHERSHEGGASSAHLPAAKPIASRVISTRSCRNVPP
LTSNSVSAAKPAPSHAHFLLNSLVQFRQENGSQPSPSPRECPTRLSRCQPGAPRKDGAES
RRALELRVSSFSDTTVQLIDAFGNSIELLTEVFGSYTLNGPKPAGATGTHVGQTEPLSSA
TAPCEQRSDRTQRDTLASSTRQSPPLPNTDTPTICPSESDLPPAGGVGGAAPSTTSEKMP
SRDPAVPLVGRHAADPLPKETEPTSVAHYQTSTEPVGSMEAITDSSPPTSSQSVVPAKGH
DGPGSWPVGDSQGTTSYETGRDVPRESPKDSAPGLSELGSLAQTEGPSGSGPGAFPENKG
NIVTEQEDNSSLSAKSTLLPREGGVTSSLVAPDAPPESVGLSVRADSEQGVAPVVGVASA
DQAGGLSGGRRLETDHSEQVGETDTCPVGLPALTTNAAKTSKLDSRSEKGSGGYKNVPGQ
NIQSGVKAVSPLPVNIKLSLVRDAHSPAIVQGTETPSANIGASDEQCDLRGEDLPSERHA
GKVSESDIAENSPSRPTKKADYVPRDSAASRCGQDPTLPEPSENEVSDPSSPQPDGTTTP
GNGLNQNPAIVDHDYSDQRSALGDTPVLSSPITADPYVESPITTDVHDVPTLGEEKNNTQ
LGGQVEQEQHSLDKRPEGDIPGNAERDTEGGTALVLSRDGDPGATVDSKSPDMDSRDSAL
PGGVQPKRSEGREDISFSEGSRWVSPMEVSFQEKVVMHENEQGANAQTSHQNDVSPPCVG
ERSLSKYTSAPSETVVPNADGVALRDAASDEVELGGTVPCFTSGKRVKGNELKDSPSHVS
SIWSKSSVTAMESESSTCPVKQESVESVSNPLEPEEPDEKANKMYGCPKCDKFFKLPVLL
AGHMKCHALHLCVTCGSPIPHKYKTKRLAKKCQQCIQKTIVKRRRERLLFPHYSEEEEDE
DMVTSGMDFALDFIEDADITLPCDPDTEGALGADPAPEAELMQLKRRRTRQRAKSAGSLG
LGPSAEHSGVQKKRGGQPSKADLIPATVPKVFKCLQCGLSFLQSASIVKHMKEHSGAQTQ
PCKCYLIVRQGEKQILKKCNVCREHTKDTASDASQLSDSPVSGSELDLPTAGPKKGIKRA
RKGDAAYRRASEKKIPQKRGKYARKSMAPVEEGHDEPYLEERSQSPSLDGELISTSWEDS
FGEESFPGRGSPHERSRDPLLKPHVCEVCGKSFRLPRYLQLHIVMHTGTPCESCGCLFRF
KRRAGRHSKKCRLCRTRGKEQGLQPDTILAQSPLVVPDAPKAKVLSSLPHGKQSKAPNQA
KRGKAFKEKKSQLLKGPSGQSRKRKLSLTQPEEGKKKPKRVEDLSPSTPKKRGRPPGKPS
TDKMLSRLKTSAIKSESKSIAVSGEGLHPGETAKSSVSGEGKPIKSDEVPTYQILPTMSI
KEEPNASEISSFLCSECGQNFPYKHLLDSHLQTHTGDRPFACPDCDKRFAKINHLTIHKR
VHTGVRPHVCSVCNSSFRQKSSLLAHRYTHANQPPLLVTLYECSICLKEFKQSSDLEAHE
CSLPVEPPVQCKDCDRVFTNKGRLAVHSRVHTEQTSYPCPICERSFIYKANLERHQQKHK
GEKPFSCAKCGVSFARRKTLERHKLAHGKKGLFSCTHCKKHFLLQSWLFRHMKICQGVGK
GKVLKRRKKIKEDVEVSSTVSSEEAEKKMIKVENKEHKIKKLVKSKLPVEPKHRSKAVEG
GKEEKLKLKVAKAEKGAMKKKLTESSQEKGEGSGVEEEKKRPNEEENVKRENKQEQLKKG
PRDILEGTSANEGKPKARGSTPAKKDMPGEEKQKAKGATTAKKELDGEQKNVSVDPSTNK
DLLGDEKPTGKGATTTKPVGEEKQKGRNVTPAKKELIGDEKLPRAKGTPPVKKPRLESNP
KVSTPDRMRKEGGKGKEPQGKLSYGTGKK
Download sequence
Identical sequences A0JP79
gi|117558061|gb|AAI27285| gi|148236948|ref|NP_001090653| ENSXETP00000008310 ENSXETP00000008310 NP_001090653.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]