SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001091172.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001091172.1.7800
Domain Number 1 Region: 15-299
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.19e-62
Family FCH domain 0.0032
Further Details:      
 
Domain Number 2 Region: 332-403
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-20
Family SH3-domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001091172.1.7800
Sequence length 404
Comment uncharacterized protein LOC100036932 [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MSGIYSEVAADENTSDSFWMPNNYSSTVKRTEDGHRLCDEIVACFQDRAKIERQYALQME
EWTHKWKPLVDSSPMYGSLLRAWQAFMSATERLSELHTQIQKTLVAEDSEKIRTWQKETY
HRKIFGGFKESCEIENGFHKAQKPWAKKLKKVENSKAAYHKACKKEHLAIVRENSSKINP
ELSQEKLKKLTEDHEKCTQDKEKVKQRYEKSLQELNKYNPKYMEEMETVFDQSQQQEQKK
ILFLKQVLGSMHKHLDITTNESAKTVYGDLNDAIVAVNDQEDLKWWKNKHGPGMIMNWPQ
LKEWTPDTEQQIVKKKTVKETDKVKLYSVTPTESSQNKAPINVPGVRVRAVYDYSGQESD
ELSFKAGDDLTKIEDEDEQGWCKGVTDKGQVGLYPANYVEVISG
Download sequence
Identical sequences A1L2S0
NP_001091172.1.7800 gi|120538016|gb|AAI29683| gi|147906566|ref|NP_001091172|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]