SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001092937.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001092937.1.4139
Domain Number 1 Region: 51-499
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.14e-99
Family L-arabinose binding protein-like 0.0025
Further Details:      
 
Weak hits

Sequence:  NP_001092937.1.4139
Domain Number - Region: 509-556
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00377
Family TNF receptor-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001092937.1.4139
Sequence length 849
Comment vomeronasal 2 receptor 30 precursor [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MFILMVVFFFLNLPHLMANFTDPRCFWRINLDEDQNKDLGISCSFILGAVQLPMEKDYFN
QTLNVLKTTKTNKYALVLAFSMNEINRNPDLLPNMSLVIKHTLSYCDGKTVHHIVKEKFY
NPLPNYICNEETMCSFLLTGLNWISSIKLFRELDVFLFPRFLQISYGPFHSIFSDNEQFP
YVYQMTPKDTLLPLAMVSIIHYFNWNWVGLVISDNDEGNQFLSELKKETQTKEICFAFVT
MMTINDLSSYHKTEMYYNEIVMSSTNVIIIYGETDSIIELSFRMWKSPVIQRIWITKSEL
DFPTSNGDLSHDIFYGTLTFLHHHGEISGFKNFVETRYHLKSRDLNLLIPEWNYFNYEAS
ASNCKILRNYSSNSSLEWLTEQKFQMAFNDESNSIYNAVYAMAHALHEKNLQEVDNQEIK
NGKRTSTHCLKLNSFLRKTHFTNPLGDKVIMKQRERVQEDYDIVHIQNFSQRLRIKVKIG
KFSPYFPHGGRFHLYEEMIELATGSRKMPSSVCSADCSPGFRKIWKEGMAACCFICSPCP
ENEISNETNMDQCVNCPEYQYANKEKNKCIQKGVIFLSYEDPLGMVLALIAFCLSVFTAV
VFCVFVKNHDTPIVKANNRILSYLLVMSLMFCFLCSFFFIGHPNNATCILQQITFGITFT
VAVSTVLAKTITVVLAFKITDPGRMLRNFLVLGAPNYIIPICSLLQCILCAIWLAVSPPF
VDIDKHSEHGHIIIVCNKGSVMAFYCVLGYLACLALGSFTMAFLAKNLPDTFNEAKYLTF
SILVFFSVWVTFLPVYHSTKGRVMVAVEIFSILSSSAGMLGCIFTPKIYIILVKPERNSI
QRIREKSYF
Download sequence
Identical sequences ENSRNOP00000043829 NP_001092937.1.100692 NP_001092937.1.4139 10116.ENSRNOP00000043829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]