SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001092950.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001092950.1.4139
Domain Number 1 Region: 67-512
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.07e-113
Family L-arabinose binding protein-like 0.00068
Further Details:      
 
Weak hits

Sequence:  NP_001092950.1.4139
Domain Number - Region: 520-566
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00113
Family TNF receptor-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001092950.1.4139
Sequence length 864
Comment vomeronasal 2 receptor 60 precursor [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MMLLLIFMFLLLQYSSDVYSFDRSSCAAKTKTSVYKDGDMVLAAFLPLFTITIDSASDNQ
SNNNFYIHQHVKECKFIHSFHFIVLAMVYAIEEINRNPHILPNVSLGYDIYNVLFNEWWI
LNRCITWLSGPKKYVPNYTCRREMKSIAALTGISWIISTNIGTLLELYKYPQLTIGSFDP
NLNNHEQFHDIYQIAYKDMSLTHGIVSLLNYFHWNWVGLIVSEGQNGFQIISELRAEMDR
NKICVDFVEMIRVSEVSYLPSYLLSPTHLAKSTANVIITYGDSDFMRGFLFYLRQILVTR
KVWIMNSDWDVIIQSKHFILQSFHGSLIFAHHHKETSGYRNFIQTVHPSKYPEDFYLTRF
WFYFFNCSFADDDCNTLENCLPNASLHETPGSHFDMVMTEFAYNIYNAVYAVAHSLHKML
LQQVEVTPVKEAEDLIFSAWQLHPFLKNMQFTNPAGEQVNLNEKMKLNADYDILNYWNFP
EGLQLKVKVGQFSPYGPLGQQLSLSEDTIEWPTEITETPRSICSESCGPGFRKSLPEGKV
SCCFDCVPCPENEISNETDVDQCMQCLDHQYANTAQNHCLQKSMTFLDYEDPMGISLSCI
ALCFSALTSLVLSIFLKQKNTPIVKANNRTLTYILLIALNFCFLCSFLFIGHPNTATCIL
QQTTFAVVFTVAVSTVLAKTITVVLAFKVTAPGRRIRWLLVTRAPNFIVPICTLIQIILC
GVWLGNSPPFIDTDTRSEHEHIIIMCNKGSVTAFYCVQGYLGALALGSFTLAFLARNLPD
TFNEAKFLTFSMLVFCSVWVTFLPVYHSTKGKHMVVVEVFSILVSSAGLLGCIFAPKCYI
ILLRPQRNSIQGHRDKIHYNYKTS
Download sequence
Identical sequences NP_001092950.1.100692 NP_001092950.1.4139 10116.ENSRNOP00000042646 ENSRNOP00000042646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]