SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001092960.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001092960.1.100692
Domain Number 1 Region: 52-504
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.9e-105
Family L-arabinose binding protein-like 0.0038
Further Details:      
 
Weak hits

Sequence:  NP_001092960.1.100692
Domain Number - Region: 506-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0148
Family TNF receptor-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001092960.1.100692
Sequence length 857
Comment vomeronasal 2 receptor, 15 precursor [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MFTLSLFFLLLNIPLLMTCLIYPRCFWSMRQDEYENRSLERGCAFFIRAVKWPVEKEYFS
NALNIQTHTENQKYALALAFSMNEINLNPNLLPNMSLVFTYSTDACDWEAIFKSVIHLDL
QEHKILPNYICTEDIKCGVALTGFNWATTVTIHILLNNFIFQKFIHLTYGSFYPVLSDHE
KFPYLYQMASEDTSLALALVSFIIHFSWNWVGLAISDNDKGTQFLSYLRREMEKNTVCFA
FVNMIPVNMRLFMSRAEVYYNQIMTSSTNVVIMYGDKDSTLAVSFRMWVSLGIQRIWITT
AQWDVTPRMKDLTFDNLCGTFAFGQHHGEIYGLKNYAQTLNPFIYSDEYLLKLEWMYFNC
NVTASKWKPFKNCSSNHSLEWLMTHTFDMAFIEGSYDIYNAVYAFAHALHQVTFQKGDNL
PTDNRKEQDYDCKKLCSFLRKTHFTNPAGDRVNMNQIEKLQEEYDIFYIWNFPQGIGLKL
KIGIFSPYFQTGQHLHLSEDIIEWAKEGSQMLTSVCSADCGPGFRKFRKNGMPACCFDCS
PCPENKISNETNVEMCILCPEDQYANTEQNHCIQKPLIFLTYEEPLGITISLMALCFSAL
TAVILGVFVKHHSTPIVKASNHILTYILLISLIFCFLCPLLFIGHPNSATCILQQITFGV
VFTVAISTVLAKTITVILAFKVTAPQRMMKYFLVQRASNYIIPMCTLIQVIVCAVWLGAS
PPFVDIDTQSEHGHIIIVCNKGSVTAFYCVLGYLACLSFASFFLAFFSRNLPGNFNEAKS
MTFSMLLFCSVWITFLPVYHGTKGKVMVAVEIFSTLASSAGMLGCIFIPKCYTILFRPDK
NSLQMIREKLSSHTHIS
Download sequence
Identical sequences D3ZPC9
ENSRNOP00000049930 NP_001092960.1.100692 NP_001092960.1.4139 10116.ENSRNOP00000049930 ENSRNOP00000049930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]