SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001093156.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001093156.1.87134
Domain Number 1 Region: 375-558
Classification Level Classification E-value
Superfamily NTF2-like 2.03e-64
Family NTF2-like 0.000000836
Further Details:      
 
Domain Number 2 Region: 111-205
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.56e-36
Family Non-canonical RBD domain 0.000077
Further Details:      
 
Domain Number 3 Region: 209-363
Classification Level Classification E-value
Superfamily L domain-like 3.91e-32
Family mRNA export factor tap 0.0000033
Further Details:      
 
Domain Number 4 Region: 556-622
Classification Level Classification E-value
Superfamily UBA-like 1.73e-24
Family TAP-C domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001093156.1.87134
Sequence length 626
Comment nuclear RNA export factor 2 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MCSTLKKCGTYRTEVAECHDHGSTFQGRKKGGSSFRDNFDKRSCHYEHGGYERPPSHCQE
NDGSVEMRDVHKDQQLRHTPYSIRCERRMKWHSEDEIRITTWRNRKPPERKMSQNTQDGY
TRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRACFFVQDASAASALKDV
SYKIYDDENQKICIFVNHSTAPYSVKNKLKPGQMEMLKLTMNKRYNVSQQALDLQNLRFD
PDLMGRDIDIILNRRNCMAATLKIIERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKT
LNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRE
LSAPVIVDIDSSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEAC
FSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHD
LSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSSLCIVNDELF
VRDASPQETQSAFSIPVSTLSSSSEPSLSQEQQEMVQAFSAQSGMKLEWSQKCLQDNEWN
YTRAGQAFTMLQTEGKIPAEAFKQIS
Download sequence
Identical sequences Q9GZY0
ENSP00000331471 ENSP00000361835 ENSP00000361836 ENSP00000361843 ENSP00000361844 ENSP00000378523 ENSP00000396447 ENSP00000413087 ENSP00000469776 ENSP00000472530 ENSP00000472530 ENSP00000474598 ENSP00000474659 ENSP00000484645 9606.ENSP00000361835 9606.ENSP00000361843 NP_001093156.1.87134 NP_001093156.1.92137 NP_071336.1.87134 NP_071336.1.92137 gi|13430854|ref|NP_071336.1| gi|14277694|ref|NP_060279.2| gi|153791282|ref|NP_001093156.1| ENSP00000361836 ENSP00000361843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]