SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001093519.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001093519.1.45394
Domain Number 1 Region: 168-241
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.99e-25
Family PHD domain 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001093519.1.45394
Sequence length 242
Comment inhibitor of growth protein 5 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MATAIYLEHYLDSIENLPCELQRNFTLMRELDNRAEEKKCEIDKLAEEYIANVRNLAPDQ
RVEHLQKIQNGFSKCKEYSDDKVQLAMQTYEMVDKHIRRLDADLARFENELKEKLDVSGY
ESPDNRTHKKVTGRGNLKEKRRPKGRGRKSSDDESPRKKKMKNSPEFPESILPVHPSDVL
DMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCTQDRK
KK
Download sequence
Identical sequences A5WVS7
NP_001093519.1.45394 ENSDARP00000040700 7955.ENSDARP00000034139 ENSDARP00000040700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]