SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001093675.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001093675.1.99540
Domain Number 1 Region: 312-519
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.73e-66
Family Nuclear receptor ligand-binding domain 0.0000237
Further Details:      
 
Domain Number 2 Region: 112-200
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.15e-29
Family Nuclear receptor 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001093675.1.99540
Sequence length 522
Comment nuclear receptor subfamily 1 group D member 1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MTTLDCANNTGGVISYVGSSGSSPNRTSPVSMYSDCSSGSPQSGVSHYANYLPPSPSHSY
SASSSGSGGEASPRSSYGLAASPGGLHVALDDGSRVSPSKTSSSITKLNGMVLLCKVCGD
VASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNETCSIVRINRNRCQQCRFRKCLSVG
MSRDAVRFGRIPKREKQRMLAEMHSAMNHIASGHFGRRSPIPLQPHQQQQQQLHPSSSPL
MGTAPCHSPTSLPDAYSQYPQQLTPPRSPSPEHMDDVISQVSMAHRQIFVYANDKVNKKT
SWDHPQPCWSHDTEDSHGNHNIRLACPMNALHRGGPVRSVQEVWEDFSLSFTPAVREVVE
FARHIPGFKDLTQNDQVTLLKAGTFEVLMVRFASLFDAREHSLRFLSGATYSLPELHAMG
MGELLSSMFDFSEKLSSLSLSQEELGIFTALVLVSADRSGMENSSLVEQLQETLIRALRS
LILKNSPNDTSRFTKLLLRLPDLRTLNNMHSEKLLSFRVDAH
Download sequence
Identical sequences A4IIE9
gi|134025606|gb|AAI35991| gi|154147686|ref|NP_001093675| NP_001093675.1.99540 8364.ENSXETP00000052764 ENSXETP00000052764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]