SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001093677.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001093677.1.99540
Domain Number 1 Region: 127-394
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.55e-70
Family Nuclear receptor ligand-binding domain 0.0000098
Further Details:      
 
Domain Number 2 Region: 71-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001093677.1.99540
Sequence length 410
Comment COUP transcription factor 1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MAMVVSSWRDPQEDVAGGNPGGPNPGAREQQQAPSAAPHTPQTPSQPGPPSTPGAAGDKG
QQGSGQSQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQ
HHRNQCQYCRLKKCLKVGMRREVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLL
RAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVALLR
LTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALH
VDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLR
LPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMPIQCS
Download sequence
Identical sequences A4QNF4
gi|138519913|gb|AAI35590| gi|154147672|ref|NP_001093677| NP_001093677.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]