SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001093707.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001093707.1.99540
Domain Number 1 Region: 182-269
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.06e-23
Family Thyroglobulin type-1 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 24-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-22
Family Growth factor receptor domain 0.0000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001093707.1.99540
Sequence length 284
Comment insulin-like growth factor-binding protein 2 precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MGLSRYLLGLLLGVLCTPAPAEVLFRCPPCSPERLATCPGSAPRPPCAELVRAPGCGCCP
VCARLEGESCGVYTARCAGGLRCYPHPGSELPLQALVLGLGTCGKRRDTEYGSSQERGTE
LPEERSDNMLVDNKLEAGPAVAGEAAPRKPSKKEMKEIAVTRERANEQQRSKSNKSEDKK
RPARSLCQLQLDQVLERISGMHLPDDRGPLEHLYALHIPNCDKNGFFNLKQCKMSVNGQR
GECWCVNPITGKALPGSPTIRGDPECHLYYTSPEEGRAHTQRAP
Download sequence
Identical sequences A4IIA2
NP_001093707.1.99540 gi|134026148|gb|AAI35929| gi|154147617|ref|NP_001093707| gi|257096544|gb|A4IIA2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]