SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001093738.2.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001093738.2.99540
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.47e-16
Family Ovomucoid domain III-like 0.0043
Further Details:      
 
Domain Number 2 Region: 170-227
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000568
Family Ovomucoid domain III-like 0.0075
Further Details:      
 
Domain Number 3 Region: 262-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000233
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001093738.2.99540
Sequence length 372
Comment tomoregulin-1 precursor [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mdglhpaswmlllgslafwsasslllfslalpgvrasnplpsechngkgkagincselsl
resevrrvcdestckyggvckeegdvlkcicqfqcqtnyapvcgsngdtyqnecflrrsa
ckqqkeitvvargpcfsdiasgsgegeyegsggevhkkhskcgnckfgaecdedaedvgc
vcnidcsghnfnpvcatdgssysnpclvreasclrqeqidvkhlrscietdetsimgkkd
egiqnrpevkdstdqregdfmgnyipcsenyngycvhgkcelsystqkascrcdsgytgq
ycdktdfnilyvvpsrqklthvliaaiigavqiaiivaivmcitrkcpknnrgrrqkqnl
ghfssdassrmv
Download sequence
Identical sequences gi|350529440|ref|NP_001093738| NP_001093738.2.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]