SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001093950.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001093950.1.4139
Domain Number 1 Region: 8-165
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.09e-67
Family TRADD, N-terminal domain 0.000000343
Further Details:      
 
Domain Number 2 Region: 218-305
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000226
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001093950.1.4139
Sequence length 310
Comment tumor necrosis factor receptor type 1-associated DEATH domain protein [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MAADQNGHEEWVGSAYLFLESSMDKVVLSEAYTDPKKKVAIYKALQAALSESGDSPDVLQ
ILKIHCSDPQLIVQLRFCGRLLCGRFLQAYREGALRTALQRCMAAALAQEAVRLQLELRA
GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDEFCKLTCDSTGQGGATQVAPAGS
KSLVSSPAEEKPLPAAGQTFLFHGQLIVNRPLNLQDQQTFARSVGLKWRRVGRSLQRSCR
ALRDPALDSLAYEYERDGLYEQAFQLLRRFIQAEGRRATLQRLVEALEENELTSLAEDLL
GQAEPEGGQA
Download sequence
Identical sequences D3ZZC5
NP_001093950.1.100692 NP_001093950.1.4139 XP_006255506.1.100692 ENSRNOP00000020405 10116.ENSRNOP00000020405 ENSRNOP00000020405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]