SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001094577.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001094577.1.59421
Domain Number 1 Region: 211-482
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.06e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000224
Further Details:      
 
Domain Number 2 Region: 9-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000809
Family MarR-like transcriptional regulators 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001094577.1.59421
Sequence length 508
Comment phenylalanine--tRNA ligase alpha subunit [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MADGPVAEVLLRRLEAADGGLDSAELATELGVEHQTVVGAVKSLQALGQIIETELRSTKR
WELTAEGEEIAQEGSHEARVFRSIPPEGLPQSELMRLPSGKVGFSKAMSNKWIRVDKSAA
DGPRVFRVVDSVEDEVQRRLQLVRGGQAEKLGEKERSELRKRKLLTEATLKTYWVSKGSA
FSTSISKQETELSPEMISSGSWRDRPFKPYNFSAHGVLPDSGHLHPLLKVRSQFRQIFLE
MGFTEMPTDNYIESSFWNFDALFQPQQHPARDQHDTFFLRDPAQAQQLPMDYVHRVKRTH
SQGGYGSQGYKYTWKLDEARKNLLRTHTTAASARALYRLAQKKPFTPAKYFSIDRVFRNE
TLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEIF
SYHQGLKKWVEVGNSGIFRPEMLLPMGLPENVSVIAWGLSLERPTMIKYGINNIRELVGH
KVNLQMVYDSPLCRLDAERGPPSTQEAA
Download sequence
Identical sequences A7MBD4
NP_001094577.1.59421 NP_001094577.1.76553 XP_019819602.1.53367 ENSBTAP00000028494 ENSBTAP00000028494 9913.ENSBTAP00000028494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]