SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001094718.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001094718.1.59421
Domain Number 1 Region: 233-319
Classification Level Classification E-value
Superfamily SH2 domain 4.23e-47
Family SH2 domain 0.00000948
Further Details:      
 
Domain Number 2 Region: 9-146
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 5.49e-41
Family N-terminal domain of cbl (N-cbl) 0.00035
Further Details:      
 
Domain Number 3 Region: 147-232
Classification Level Classification E-value
Superfamily EF-hand 3.06e-37
Family EF-hand modules in multidomain proteins 0.00013
Further Details:      
 
Domain Number 4 Region: 325-403
Classification Level Classification E-value
Superfamily RING/U-box 4.16e-37
Family RING finger domain, C3HC4 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001094718.1.59421
Sequence length 491
Comment E3 ubiquitin-protein ligase CBL-C [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MAAAALRGRQWGESRAFGRAVRLLQRLEEQCGDPRLSSSPPSLRDLLPRTAQLLRQVAQA
RREAGGGVPEGPGGPWDFLMVYLANLEAKSRQVAALLPPHGRKIANDELFREGSRLRRQL
AKLALIFSYMHAELDALFPGGRYCGHTYQLTKVSAHTFWRERCGARCVLPWAEFEAVLCI
CHPVEPGSTALALRSTIDLTCSGHVSIFEFDIFTRLFQPWPTLLKNWQLLAVNHPGYMAF
LTYDEVQARLQTFRDKPGSYIFRPSCTRLGKWAIGYVSSDGSILQTIPLNKPLFQVLLEG
QKEGFYLYPDGKNHNPDLTELCHMEPHQHIHVSEEQLQLYWAMDSTFELCKICAESNKDV
KIEPCGHLLCSRCLAAWLCSDSQTCPFCRCEIKGQEAVSIHQFHVSATVEDPEHSSDEEE
LEQMAPSGPPLPPRLDLCPKSPSSKGHLNVAPPTLPRLRAPLPLPRFWTAASAPWEVTSS
PQAREGARGNS
Download sequence
Identical sequences A6QPZ5
9913.ENSBTAP00000041264 ENSBTAP00000041264 ENSBTAP00000041264 NP_001094718.1.59421 NP_001094718.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]