SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001095443.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001095443.1.76553
Domain Number 1 Region: 201-441
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.82e-85
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 109-208
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000196
Family Hepsin, N-terminal domain 0.07
Further Details:      
 
Domain Number 3 Region: 63-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000877
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001095443.1.76553
Sequence length 445
Comment transmembrane protease serine 4 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MENSEDRRARVDPEINRPLNSLDVTPLRKSRTPLEIFKKVGIPIIAAVLILATIIVVAVL
IKVILDSYFFFCGQPLLFIPREQVCDGHQDCASGEDEKYCVKKLPDGPPVAVRLSRDRST
LQVLNPATKNWASACFDSFTEALAKTACRQMGYDSKPTFRAVDAGPAQDLDIVKVTENLQ
ELQVQNSSGPCLSGSLVSLQCLACGQSVKAPRVVGGKEASVDSWPWQVSIQYDKQHICGG
SILDPHWILTAAHCFWKHLDVPNWKVRAGSDRLGSFPSLPVAKIFILEPNATYPREHDIA
LVKLQLPLTFSGTIRPICLPFSDEELTPGTPLWVIGWGFTEENGGKMSDILQQGSVQLIN
RTRCNAEDAYQGEVTKTMMCAGLPEGGVDTCQGDSGGPLMYHSDWWQVVGIVSWGHGCGG
PTTPGVYTKVTAYLNWIYNVRKSDP
Download sequence
Identical sequences A7E330
NP_001095443.1.59421 NP_001095443.1.76553 ENSBTAP00000051578 9913.ENSBTAP00000028678 ENSBTAP00000028678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]