SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001095763.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001095763.1.76553
Domain Number 1 Region: 243-531
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-87
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001095763.1.76553
Sequence length 539
Comment tyrosine-protein phosphatase non-receptor type 5 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MCCSERLPGVPQPVGMEALDQAEGPAASQREMPPPPPASPPSEPAQKPPPRGAGSHSLTA
RSSLCLLAASQFLLACGMLWLSGFGPIWTQNTTDVVSSALTFLEQLGPSAWLGTGTWDAP
SLLLVSLCVILITTLVWLLLRTPPEPTSPLPPEDRRQSVSRQPSFTYSEWMEEKVEDDFL
DLDPVPETPVFDCVMDIKLEADPTSLTVKAMGLQERRGSNVSLTLDMCTPGCNEEGFGYL
MSPREESAREYLLSASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKN
RYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVGDFWRM
VWQEHTPIIVMITNIEEMNEKCTEYWPEEQVVYDGVEITVRKVIHTEDYRLRLIALRSGT
EERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIVVHCSAGIGRTGCF
IATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSRQSPE
Download sequence
Identical sequences A6QQD4
9913.ENSBTAP00000026996 ENSBTAP00000026996 NP_001095763.1.59421 NP_001095763.1.76553 ENSBTAP00000026996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]