SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001096127.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001096127.1.87134
Domain Number 1 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-26
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 758-815
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.77e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 590-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 814-871
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 534-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 8 Region: 478-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 10 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.76e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 11 Region: 646-703
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 12 Region: 199-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.1e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 13 Region: 856-908
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 14 Region: 702-759
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-17
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001096127.1.87134
Sequence length 936
Comment zinc finger protein 836 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MALTQGPLTFRDVAIEFSQEEWKSLDPVQKALYWDVMLENYRNLVFLGILPKCMTKELPP
IGNSNTGEKCQTVTLERHECYDVENFYLREIQKNLQDLEFQWKDGEINYKEVPMTYKNNL
NGKRGQHSQEDVENKCIENQLTLSFQSRLTELQKFQTEGKIYECNQSEKTVNNSSLVSPL
QRILPSVQTNISKKYENEFLQLSLPTQLEKTHIREKPYMCKGCGKAFRVSSSLINHQMVH
TTEKPYKCNECGKAFHRGSLLTIHQIVHTRGKPYQCGVCGKIFRQNSDLVNHRRSHTGEK
PYKCNECGKSFSQSYNLAIHQRIHTGEKPYKCNECGKTFKQGSCLTTHQIIHTGEKPYQC
DICGKVFRQNSNLVNHQRIHTGEKPYKCNICGKSFSQSSNLATHQTVHSGNKPYKCDECG
KTFKRSSSLTTHQIIHTGEKPYTCDVCDKVFSQRSQLARHQRSHTGEKPYKCNECGKVFS
QTSHLVGHRRIHTGEKPYKCDKCGKAFKQGSLLTRHKIIHTREKRYQCGECGKVFSENSC
LVRHLRIHTGEQPYKCNVCGKVFNYSGNLSIHKRIHTGEKPFQCNECGTVFRNYSCLARH
LRIHTGQKPYKCNVCGKVFNDSGNLSNHKRIHTGEKPFQCNECGKVFSYYSCLARHRKIH
TGEKPYKCNDCGKAYTQRSSLTKHLIIHTGEKPYNCNEFGGAFIQSSKLARYHRNPTGEK
PHKCSHCGRTFSHITGLTYHQRRHTGEMPYKCIECGQVFNSTSNLARHRRIHTGEKPYKC
NECGKVFRHQSTLARHRSIHTGEKPYVCNECGKAFRVRSILVNHQKMHTGDKPYKCNECG
KAFIERSKLVYHQRNHTGEKPYKCIECGKAFGRFSCLNKHQMIHSGEKPYKCNECGKSFI
SRSGLTKHQTKHTAESLKTKFNVEKPLDVLLTSGFK
Download sequence
Identical sequences Q6ZNA1
gi|156627573|ref|NP_001096127.1| ENSP00000325038 ENSP00000470239 ENSP00000325038 ENSP00000470239 9606.ENSP00000325038 NP_001096127.1.87134 NP_001096127.1.92137 XP_011524860.1.92137 XP_011524861.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]