SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001096158.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001096158.1.99540
Domain Number 1 Region: 1259-1347,1376-1597
Classification Level Classification E-value
Superfamily NHL repeat 1.23e-23
Family NHL repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 1501-1745
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.000000246
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.031
Further Details:      
 
Domain Number 3 Region: 954-1024
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000294
Family Pre-dockerin domain 0.04
Further Details:      
 
Domain Number 4 Region: 672-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000534
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  NP_001096158.1.99540
Domain Number - Region: 802-827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 772-796
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family Integrin beta EGF-like domains 0.078
Further Details:      
 
Domain Number - Region: 705-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00199
Family EGF-type module 0.068
Further Details:      
 
Domain Number - Region: 638-665
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00649
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 831-864
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00764
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 609-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0429
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001096158.1.99540
Sequence length 2799
Comment teneurin-4 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MDVKERKPYRSLTRRRDTERRYTSSSADSDDSKVPQKSYSSSETLKAYDQDSRLTYSNRV
KDMVHQEIDEFCRSGGSFTLHELGLGEVSPPHGTLYRTDLGLPHCGYSMTSDNDADTEPD
AVLSPEHPVRLWARSTKSGRSSCLSSRANSNLTLTDTEHENTENGPPLHCSSASSSPIEQ
TPSPPPSPAANECQRRLLGSSVAPAAAAAAAQDSDSEGDFVPNSFLVKSDSANLAVPAND
QPLVLQNHLRLRTPPPPLSHPQIPHHAASINSLNRGNYTPRSNPSPAPTDHSLSGEPPGG
GQEAIHAQDNWLLNSNIPLETRHFLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRS
TFSRPAFNLKKPYKYCNWKCAALSAIIISVTLVILLAYFIAMHLFGLNWHLQPAEGQMYE
ITEDRGSSWPVPTDVTLYPSGGTGLELPERKGKGTSEGKPNSLFPEETFIDSGELDVGRR
ATQKIPPGIFWRSQVFIDHPVHLKFNVSLGKAALVGIYGRRGLPPSHTQFDFVELLDGRR
LLVQEARGLEVPQRLHRVIAPLSSHETGFIQYLDSGIWHLAFYNDGKETEVVSFLTTAIE
SVDDCPSNCYGNGECVAGNCHCFLGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGA
ECDVPTSQCIDITCSNHGTCIMGTCICNPGYKGENCEEVDCIDPTCSGRGVCVRGECHCA
IGWGGASCENPRATCLDQCSGHGTYQTETGVCSCDPNWTGHDCSTEICAADCGGHGMCIG
GSCRCDEGWMGTACDQRACHPRCNEHGTCRDGKCECSPGWNGEHCTIEGCPGLCNGNGRC
TLDLNGWHCVCQVGWRGSGCDISMETACNDGKDNDADGLVDCMDPDCCLQHSCQTSSLCL
GSPDPLDIIQETQAPVPHQNLQSFYNRVKFLIGKDSTHYIPGENPFNRGHACVIRGQVIT
SDGTPLVGVNISFVGLSAFGYTISRQDGSFDLVTNGGVSITLRFERAPFITQEHTLWLPW
DRFFVMETITMRHEENEIPSCDLSSFARPNPVLSPAPLTAFASSCSAKGPIVPEIQALQE
EIPIPGSKIRLSYLSSRNAGYKSVLRISLTHPTIPFNLMKVHLMVAVEGRLFRKWFSAAP
DLSYFFIWDKTDVYSQKVYGLSEAFVSVGYEYESCPDLILWEKRTAVLQGYEIESSKLGG
WSLDKHHALNIQSGILHKGNGENQFISQQPPVIGSTMGNGRRRSISCPSCNGLADGNKLL
APVALTCGPDGSIYVGDFNFIRRIFPSGNVTSILELRNKEFRHSHSPAHKYYLATDPITG
AILLSDTNSRRVYKIKSTNVVKEFAKNSEVIAGTGDQCLPFDDTRCGDGGKAIEASLNNP
RGITVDKFGLIYFVDGTMIRRIDQNGIISTLLGSNDLTSARPLSCDSVMDISQVRLEWPT
DLAVNPMDNSLYVLDNNVVLQISENHQVRIVAGRPMHCQVPGIDHFLLSKVAIHATLEAA
VALAVSHNGILYISETDEKKINRIRQVTTNGEISLVAGAPSGCDCKNDANCECFSGDDGY
AKDAKLNSPSSLAVCADGELYVADLGNIRIRFIRTNKPFLNSQNMYEVSSPIDQELYLFD
TTGRHLYTQSLTTGDYLYNFTYTGEGDLTLITDNNGNTLNVRRDSTGMPLWLVVPDGQVY
WLTIGTNSALKSVSAQGHELAMMTYHGNSGLLATKSNEDGWTTFYEYDTFGRLTNVTFPT
GQVSSFRGDTDSSVHVQMETSNKEDVTITTNLSASGAFYTLLQDQVRNSYYIGADGSLRL
ILANGMEVALQTEPHLLAGTVNPTVGKRNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRR
LRVHNRNLLSLDFDRVTRTEKIYDDHRKFTLRILYDQAGRPSLWSPSSRLNGVNVTYSPG
GHVAGIQRGTMSERMEYDQTGRIISRTFADGKTWGYTYLEKSMVLLLHSQRQYIFEFDKN
DRLSSVTMPNVARQTMETVRSIGYYRNIYRPHEGNASVIQDFSEEGQLLQTLHMGTGRRI
IYKYGKLSKLAEILYDTTRIAFSYDETAGMLKAINLQNEGFTCIIRYRQIGPLIDRQIFR
FTEEGMVNARFDYNYDNSFRVTSMQAVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDI
NQIITTAVMTHTKHFDTYGRVKEVQYEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTT
RYSYEYDSDGQLQTVSINDKPLWRYSYDLNGNLHLLSPGNSARLTPLRYDLRDRITRLGD
VQYRMDEDGFLRQRGGDVFEYSSAGLLVKAYNKAAGWSVRYRYDGLGRRVSRKTNLGHHL
QFFYADLANPTRVTHFYNHSSSEIASLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVF
SGTGLMIKQILYTAYGEIYLDSNPGFQIIIGYHGGLYDPLTKLIHMGRREYDVLAGRWTS
PDHDIWKRLSTTNVMPFNLYMFKNNNPVSNAQDTKCYMTDVNSWLLTFGFQLHNVIPGYP
KPDIDAMEPSYELINTQMKTQEWDNSKSILGVQCEVQKQLKAFVTLERFGQIYSSTIAGC
HLESENRKFATLGSIFGKGVKFAMKDGRVTTDIISVANEDGRRIAAILNNAQYLENLHFT
TDGIDTHYFIKQGPSENDLSILGLTGGRRTLENGVNVTVSQINTVLGARTRRYTDIQLQY
GTLCLNTRYGTTLDEEKVRVLELSRQRAVTQAWQREQQRLRDGEEGTRVWTEGEKQQLLN
TGRVQGYDGYFVISVEQYPELSDSANNIHFMRQSEMGRR
Download sequence
Identical sequences A6QL56
gi|152001048|gb|AAI46618| gi|156717232|ref|NP_001096158| NP_001096158.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]