SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001096683.1.46622 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001096683.1.46622
Domain Number 1 Region: 13-103
Classification Level Classification E-value
Superfamily DEATH domain 4.66e-21
Family Caspase recruitment domain, CARD 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001096683.1.46622
Sequence length 233
Comment B-cell lymphoma/leukemia 10 [Sus scrofa]; AA=GCF_000003025.6; RF=representative genome; TAX=9823; STAX=9823; NAME=Sus scrofa; breed=Duroc; AL=Chromosome; RT=Major
Sequence
MEPAAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
SCEPFPDGATSNLPRSNSEESNFSDKLRASTVIYHPEGESSTAPFFSTDSSLNLPVLEVG
RTEHPTFSSTTLPRPGDPGAPPLPPELRLEEEGTCGNSSEMFLPLRSRALLRQ
Download sequence
Identical sequences A7XP20
9823.ENSSSCP00000007404 9823.ENSSSCP00000007407 NP_001096683.1.46622 ENSSSCP00000007404 ENSSSCP00000007407 ENSSSCP00000007404 ENSSSCP00000007407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]