SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001096715.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001096715.1.59421
Domain Number 1 Region: 75-169
Classification Level Classification E-value
Superfamily EF-hand 2.09e-18
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001096715.1.59421
Sequence length 242
Comment EF-hand domain-containing protein D2 [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MATDELASKLSRRLQMEGEGGGEAPEQPGLNGAAAAAAAAGAPDETAEALGSADEELSAK
LLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKEYDAGRDGFIDLMELK
LMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLHVLARLS
EIDVSTEGVKGAKSFFEAKVQAMNVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQST
FK
Download sequence
Identical sequences A5D7A0
9913.ENSBTAP00000042244 ENSBTAP00000042244 ENSBTAP00000042244 NP_001096715.1.59421 NP_001096715.1.76553 XP_019832287.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]