SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001096733.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001096733.1.76553
Domain Number 1 Region: 115-239
Classification Level Classification E-value
Superfamily PH domain-like 5.17e-24
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001096733.1.76553
Sequence length 245
Comment RAB GTPase activating protein 1-like [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEVRASLQKVSGSSDSVTTLNSEEFVLVPQHGGDTSTKDDEKPELKIVSNGDEQLEKAME
EILRDSEKGQSSLPVDCPSSSEISDHSFGNISARQTNKPSLQLILDPSNTEISTPRPSSL
SEIPEEDSVLFNKLTYLGCMKVSSPRNEVEALRAMATMKSASQHPFPVTLYVPNVPEGSV
RIIDQSNNMEIASFPIYKVLFCARGHDGTTESNCFAFTESSHGSEEFQIHVFSCEIKEAR
WGSRW
Download sequence
Identical sequences A6QPS3
NP_001096733.1.59421 NP_001096733.1.76553 ENSBTAP00000019777 ENSBTAP00000019777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]