SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001096865.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001096865.1.81976
Domain Number 1 Region: 1283-1349
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.57e-17
Family SAM (sterile alpha motif) domain 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001096865.1.81976
Sequence length 1359
Comment polyhomeotic distal, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MEVQQQLQLQQQLSEANGGGAASAGAGGAASPANSQQSQQQQHSTAISTMSPMQLAAATG
GVGGDWTQGRTVQLMQPSTSFLYPQMIVSGNLLHPGGLGQQPIQVITAGKPFQGNGPQML
TTTTQNAKQMIGGQAGFAGGNYATCIPSNHNQSPQTVLISPVNVISHSPQQQQNLLQSMA
AAAQQQQLTQQQQQQLNQQQQQLNQQQQQQQLTAALAKVGVDAQGKLAQKVVQKVTTTSS
TVQAATGPGSTGSTQTQQVQQVQQQQQQTTQTTQQCVQVSQSTLPVGVGGQSVQTAQLLN
AGQAQQMQIPWFWQNAAGLQPFGSNQIILRNQPDGTQGMFIQQQPATQTLQTQQNQIIQC
NVTQTPTKARTQLDALAPKQQQQQQQVGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRP
GAPVMPHNGTQVRPASSVSTQTAQNQSLLKAKMRNKQQPVRPALATLKTEIGQVAGQNKV
VGHLTTVQQQQQATNLQQVVNAAGNKMVVMSTTGTPITLQNGQTLHAATAAGVDKQQQQL
QLFQKQHILQQQMLQQQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQA
VAQAQQQQREQQQQVAQAQAQHQQALANATQQILQVAPNQFITSHQQQQQQQLHNQLIQQ
QLQQQAQAQVQAQVQAQAQQQQQQREQQQNIIQQIVVQQSTGATSQQQQQQPQQQSGQLQ
LSSVPFSVSPSMTAEDIAGITSSALQEALSVSGAIFQTTKPITCSSSTLPTSSVVTITSQ
SSTPLVTSSTVASMQQAQTQGTQIHQHQQLISATIAGGSQQQQQQQQLGLPSLTPTTPSP
TTNPILAMTSMMNATVGHLSTAPPVSVSSTAVTPSSGQLVTLSSASSGGGAGFPATPTKE
TPSKGPTATLVPIDSPKTPVSGKDTCTTPKSSTPATVSASVEASSSTGEALSNGDASDRS
STPSKGATTPTSKQSNAAVQPPSSTIPNSVSGKEEPKLTTCGSLTSATSTSTTTTITNGI
GVARTTASTAVSTASTTTTSSGTFTTSCTSTTTTTTSSISNGSKDLPKAMIKPNVLTHVI
DGFIIQEANEPFPVTRQRYADKDVSDEPPKKKATMQEDIKLSGIASAPGSDMVACEQCGK
MEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRLDEAMAEE
KMQTESYQTVSDALPIQAATPEVPPISMPVLAAMSTSSPLSLPLTLPLPIAIAPTVSLPV
VSAGVVAPVLAIPSSNINGSDRPPISSWSVEEVSNFIRELPGCQDYVDDFIQQEIDGQAL
LLLKENHLVNAMGMKLGPALKIVAKVESIKEVPPGDVKD
Download sequence
Identical sequences Q9NF31
FBpp0111756 NP_001096865.1.81976 FBpp0111756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]